| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (29 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
| Domain d3o6fg1: 3o6f G:1-110 [214208] Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc2, d3o6fd2, d3o6fe1, d3o6fe2, d3o6fg2, d3o6fh2 automated match to d1nfda1 |
PDB Entry: 3o6f (more details), 2.8 Å
SCOPe Domain Sequences for d3o6fg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6fg1 b.1.1.0 (G:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akttqpnsmesneeepvhlpcnhstisgtdyihwyrqlpsqgpeyvihgltsnvnnrmas
laiaedrksstlilhratlrdaavyyctvyggatnklifgtgtllavqpn
Timeline for d3o6fg1: