Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries) |
Domain d3o6fe1: 3o6f E:2-81 [214206] Other proteins in same PDB: d3o6fa2, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fd2, d3o6fe2, d3o6fg1, d3o6fg2, d3o6fh1, d3o6fh2 automated match to d1jwua2 |
PDB Entry: 3o6f (more details), 2.8 Å
SCOPe Domain Sequences for d3o6fe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6fe1 d.19.1.1 (E:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]} keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala niavdkanleimtkrsnytp
Timeline for d3o6fe1: