SCOPe 2.03: Domain d3o6fe1: 3o6f E:2-81

Lineage for d3o6fe1 (3o6f E:2-81)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d3o6fe1: 3o6f E:2-81 [214206]
   Other proteins in same PDB: d3o6fa2, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fd2, d3o6fe2, d3o6fg1, d3o6fg2, d3o6fh1, d3o6fh2
   automated match to d1jwua2

Details for d3o6fe1

PDB Entry: 3o6f, 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4

PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d3o6fe1:

Sequence; same for both SEQRES and ATOM records:

>d3o6fe1 d.19.1.1 (E:2-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala
niavdkanleimtkrsnytp

Timeline for d3o6fe1:

• d3o6fe1 is new in SCOPe 2.03-stable
  
• d3o6fe1 appears in SCOPe 2.04
  
• d3o6fe1 appears in the current release, SCOPe 2.08