Lineage for d3o6fd2 (3o6f D:116-245)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029022Protein T-cell antigen receptor [49125] (7 species)
  7. 2029060Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)
  8. 2029088Domain d3o6fd2: 3o6f D:116-245 [214205]
    Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fg2, d3o6fh1
    automated match to d1ktke2

Details for d3o6fd2

PDB Entry: 3o6f (more details), 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4
PDB Compounds: (D:) T-cell receptor beta-1 chain C region

SCOPe Domain Sequences for d3o6fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6fd2 b.1.1.2 (D:116-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgradc

SCOPe Domain Coordinates for d3o6fd2:

Click to download the PDB-style file with coordinates for d3o6fd2.
(The format of our PDB-style files is described here.)

Timeline for d3o6fd2: