Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries) |
Domain d3o6fd2: 3o6f D:116-245 [214205] Other proteins in same PDB: d3o6fa1, d3o6fa2, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fe1, d3o6fe2, d3o6fg1, d3o6fg2, d3o6fh1 automated match to d1ktke2 |
PDB Entry: 3o6f (more details), 2.8 Å
SCOPe Domain Sequences for d3o6fd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6fd2 b.1.1.2 (D:116-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgradc
Timeline for d3o6fd2: