Lineage for d3o6fa1 (3o6f A:5-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938265Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
  8. 2938285Domain d3o6fa1: 3o6f A:5-81 [214200]
    Other proteins in same PDB: d3o6fa2, d3o6fa3, d3o6fc1, d3o6fc2, d3o6fd1, d3o6fd2, d3o6fe2, d3o6fg1, d3o6fg2, d3o6fh1, d3o6fh2
    automated match to d1pywa2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d3o6fa1

PDB Entry: 3o6f (more details), 2.8 Å

PDB Description: crystal structure of a human autoimmune tcr ms2-3c8 bound to mhc class ii self-ligand mbp/hla-dr4
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d3o6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6fa1 d.19.1.1 (A:5-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
hviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalania
vdkanleimtkrsnytp

SCOPe Domain Coordinates for d3o6fa1:

Click to download the PDB-style file with coordinates for d3o6fa1.
(The format of our PDB-style files is described here.)

Timeline for d3o6fa1: