Lineage for d3o5ua_ (3o5u A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773653Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
    similar overall structure to Catechol 1,2-dioxygenase
  7. 1773654Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries)
    Uniprot O67987
  8. 1773655Domain d3o5ua_: 3o5u A: [214198]
    automated match to d1s9aa_
    complexed with cl, dhb, fe, gol, myy

Details for d3o5ua_

PDB Entry: 3o5u (more details), 2.35 Å

PDB Description: crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with protocatechuate
PDB Compounds: (A:) Chlorocatechol 1,2-dioxygenase

SCOPe Domain Sequences for d3o5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5ua_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

SCOPe Domain Coordinates for d3o5ua_:

Click to download the PDB-style file with coordinates for d3o5ua_.
(The format of our PDB-style files is described here.)

Timeline for d3o5ua_: