Class b: All beta proteins [48724] (174 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species) similar overall structure to Catechol 1,2-dioxygenase |
Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries) Uniprot O67987 |
Domain d3o5ua_: 3o5u A: [214198] automated match to d1s9aa_ complexed with cl, dhb, fe, gol, myy |
PDB Entry: 3o5u (more details), 2.35 Å
SCOPe Domain Sequences for d3o5ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5ua_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]} antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid getwqlvdfnfilqhn
Timeline for d3o5ua_: