SCOPe 2.06: Domain d3o5qa1: 3o5q A:16-140

Lineage for d3o5qa1 (3o5q A:16-140)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (44 PDB entries)

8. Domain d3o5qa1: 3o5q A:16-140 [214195]
   Other proteins in same PDB: d3o5qa2
   automated match to d4drja_
   complexed with dms; mutant

Details for d3o5qa1

PDB Entry: 3o5q, 0.96 Å

PDB Description: Fk1 domain mutant A19T of FKBP51, crystal form IV, in presence of DMSO

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d3o5qa1:

Sequence; same for both SEQRES and ATOM records:

>d3o5qa1 d.26.1.1 (A:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge

Timeline for d3o5qa1:

• d3o5qa1 first appeared in SCOPe 2.03, called d3o5qa_
  
• d3o5qa1 was called d3o5qa_ in SCOPe 2.05
  
• d3o5qa1 appears in SCOPe 2.07
  
• d3o5qa1 appears in the current release, SCOPe 2.08