Lineage for d3o5qa_ (3o5q A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1899920Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1899921Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1900153Protein automated matches [191209] (3 species)
    not a true protein
  7. 1900154Species Human (Homo sapiens) [TaxId:9606] [189839] (38 PDB entries)
  8. 1900157Domain d3o5qa_: 3o5q A: [214195]
    automated match to d4drja_
    complexed with dms; mutant

Details for d3o5qa_

PDB Entry: 3o5q (more details), 0.96 Å

PDB Description: Fk1 domain mutant A19T of FKBP51, crystal form IV, in presence of DMSO
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d3o5qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5qa_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
elldfkge

SCOPe Domain Coordinates for d3o5qa_:

Click to download the PDB-style file with coordinates for d3o5qa_.
(The format of our PDB-style files is described here.)

Timeline for d3o5qa_: