| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
| Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [49102] (3 PDB entries) |
| Domain d1f4yh2: 1f4y H:118-216 [21419] Other proteins in same PDB: d1f4yh1, d1f4yl1 |
PDB Entry: 1f4y (more details), 2.8 Å
SCOP Domain Sequences for d1f4yh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4yh2 b.1.1.2 (H:118-216) Immunoglobulin (constant domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d1f4yh2: