Lineage for d3o5kd1 (3o5k D:16-140)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941584Protein automated matches [191209] (6 species)
    not a true protein
  7. 2941590Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)
  8. 2941658Domain d3o5kd1: 3o5k D:16-140 [214189]
    Other proteins in same PDB: d3o5ka2, d3o5kb2, d3o5kc2, d3o5kd2
    automated match to d4drja_

Details for d3o5kd1

PDB Entry: 3o5k (more details), 2.7 Å

PDB Description: Fk1 domain of FKBP51, crystal form VIII
PDB Compounds: (D:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d3o5kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5kd1 d.26.1.1 (D:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge

SCOPe Domain Coordinates for d3o5kd1:

Click to download the PDB-style file with coordinates for d3o5kd1.
(The format of our PDB-style files is described here.)

Timeline for d3o5kd1: