SCOPe 2.05: Domain d3o5cc1: 3o5c C:24-171

Lineage for d3o5cc1 (3o5c C:24-171)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.0: automated matches [191374] (1 protein)
   not a true family

6. Protein automated matches [190453] (18 species)
   not a true protein

7. Species Shewanella oneidensis [TaxId:70863] [226180] (1 PDB entry)

8. Domain d3o5cc1: 3o5c C:24-171 [214176]
   automated match to d1iqca1
   complexed with bu3, ca, hem

Details for d3o5cc1

PDB Entry: 3o5c, 1.8 Å

PDB Description: Cytochrome c Peroxidase BccP of Shewanella oneidensis

PDB Compounds: (C:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d3o5cc1:

Sequence, based on SEQRES records:

>d3o5cc1 a.3.1.0 (C:24-171) automated matches {Shewanella oneidensis [TaxId: 70863]}
epievitpakitepekvelgkmlffeprlsksgfiscnschnlstggvdalptsighhwq
egpinsptvlnadfmlaqfwdgrasnlkeqaagpianpkemgfthelatetiasmpayra
rfakvygdekvdidrltdaiaafektlv

Sequence, based on observed residues (ATOM records):

>d3o5cc1 a.3.1.0 (C:24-171) automated matches {Shewanella oneidensis [TaxId: 70863]}
epievitpaitepekvelgkmlffeprlsksgfiscnschnlstggvdalptsighhwqe
gpinsptvlnadfmlaqfwdgrasnlkeqaagpianpkemgfthelatetiasmpayrar
fakvygdekvdidrltdaiaafektlv

Timeline for d3o5cc1:

• d3o5cc1 first appeared in SCOPe 2.03
  
• d3o5cc1 appears in SCOPe 2.04
  
• d3o5cc1 appears in SCOPe 2.06
  
• d3o5cc1 appears in the current release, SCOPe 2.08