SCOPe 2.06: Domain d3o5ba2: 3o5b A:224-485

Lineage for d3o5ba2 (3o5b A:224-485)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (52 species)
   not a true protein

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [225987] (8 PDB entries)

8. Domain d3o5ba2: 3o5b A:224-485 [214169]
   automated match to d1ig8a2
   complexed with bgc, so4

Details for d3o5ba2

PDB Entry: 3o5b, 1.97 Å

PDB Description: crystal structure of dimeric klhxk1 in crystal form vii with glucose bound (open state)

PDB Compounds: (A:) hexokinase

SCOPe Domain Sequences for d3o5ba2:

Sequence; same for both SEQRES and ATOM records:

>d3o5ba2 c.55.1.0 (A:224-485) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
qtkmgiiigtgvngayydvvsgieklegllpedigpdspmainceygsfdnehlvlprtk
ydviideesprpgqqafekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdt
sypskieddpfenledtddlfktnlniettvverklirklaelvgtraarltvcgvsaic
dkrgyktahiaadgsvfnrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvga
aiiacltqkrlaagksvgikge

Timeline for d3o5ba2:

• d3o5ba2 first appeared in SCOPe 2.03
  
• d3o5ba2 appears in SCOPe 2.05
  
• d3o5ba2 appears in SCOPe 2.07
  
• d3o5ba2 appears in the current release, SCOPe 2.08