SCOPe 2.06: Domain d3o5aa2: 3o5a A:682-802

Lineage for d3o5aa2 (3o5a A:682-802)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.0: automated matches [191648] (1 protein)
   not a true family

6. Protein automated matches [191195] (7 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [226102] (2 PDB entries)

8. Domain d3o5aa2: 3o5a A:682-802 [214167]
   Other proteins in same PDB: d3o5aa1
   automated match to d1ogya1
   complexed with cl, fmt, hec, mgd, mos, sf4

Details for d3o5aa2

PDB Entry: 3o5a, 1.72 Å

PDB Description: Crystal Structure of partially reduced Periplasmic Nitrate Reductase from Cupriavidus necator using Ionic Liquids

PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d3o5aa2:

Sequence; same for both SEQRES and ATOM records:

>d3o5aa2 b.52.2.0 (A:682-802) automated matches {Ralstonia eutropha [TaxId: 381666]}
pdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavvfmhpedakalglrrgvevevv
srrgrmrsrietrgrdapprglvfvpwfdasqlinkvtldatcpislqtdfkkcavkivk
v

Timeline for d3o5aa2:

• d3o5aa2 first appeared in SCOPe 2.03
  
• d3o5aa2 appears in SCOPe 2.05
  
• d3o5aa2 appears in SCOPe 2.07
  
• d3o5aa2 appears in the current release, SCOPe 2.08