Lineage for d3o5aa2 (3o5a A:682-802)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798647Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 1798648Protein automated matches [191195] (6 species)
    not a true protein
  7. 1798702Species Ralstonia eutropha [TaxId:381666] [226102] (2 PDB entries)
  8. 1798704Domain d3o5aa2: 3o5a A:682-802 [214167]
    Other proteins in same PDB: d3o5aa1
    automated match to d1ogya1
    complexed with cl, fmt, hec, mgd, mos, sf4

Details for d3o5aa2

PDB Entry: 3o5a (more details), 1.72 Å

PDB Description: Crystal Structure of partially reduced Periplasmic Nitrate Reductase from Cupriavidus necator using Ionic Liquids
PDB Compounds: (A:) periplasmic nitrate reductase

SCOPe Domain Sequences for d3o5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5aa2 b.52.2.0 (A:682-802) automated matches {Ralstonia eutropha [TaxId: 381666]}
pdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavvfmhpedakalglrrgvevevv
srrgrmrsrietrgrdapprglvfvpwfdasqlinkvtldatcpislqtdfkkcavkivk
v

SCOPe Domain Coordinates for d3o5aa2:

Click to download the PDB-style file with coordinates for d3o5aa2.
(The format of our PDB-style files is described here.)

Timeline for d3o5aa2: