| Class b: All beta proteins [48724] (176 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
| Protein automated matches [191195] (6 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [226102] (2 PDB entries) |
| Domain d3o5aa2: 3o5a A:682-802 [214167] Other proteins in same PDB: d3o5aa1 automated match to d1ogya1 complexed with cl, fmt, hec, mgd, mos, sf4 |
PDB Entry: 3o5a (more details), 1.72 Å
SCOPe Domain Sequences for d3o5aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5aa2 b.52.2.0 (A:682-802) automated matches {Ralstonia eutropha [TaxId: 381666]}
pdkeypywlvtgrvlehwhsgsmtrrvpelyrsfpnavvfmhpedakalglrrgvevevv
srrgrmrsrietrgrdapprglvfvpwfdasqlinkvtldatcpislqtdfkkcavkivk
v
Timeline for d3o5aa2: