| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [225987] (9 PDB entries) |
| Domain d3o4wb1: 3o4w B:2-223 [214163] automated match to d1ig8a1 complexed with gol, nhe, so4 |
PDB Entry: 3o4w (more details), 1.61 Å
SCOPe Domain Sequences for d3o4wb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o4wb1 c.55.1.0 (B:2-223) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
vrlgpkkpparkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkgg
nipmipgwvveyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtg
tseqlwsfiakclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdieg
veghdvvpmlqeqieklnipinvvalindttgtlvaslytdp
Timeline for d3o4wb1: