SCOPe 2.02: Domain d1f4wl2: 1f4w L:111-210

Lineage for d1f4wl2 (1f4w L:111-210)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1f4wl2: 1f4w L:111-210 [21416]
   Other proteins in same PDB: d1f4wh1, d1f4wh2, d1f4wl1
   part of anti-carbohydrate Fab S-20-4

Details for d1f4wl2

PDB Entry: 1f4w, 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

PDB Compounds: (L:) antibody s-20-4, fab fragment, light chain

SCOPe Domain Sequences for d1f4wl2:

Sequence; same for both SEQRES and ATOM records:

>d1f4wl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettnpskq
snnkymassyltltarawerhssyscqvtheghtveksls

Timeline for d1f4wl2:

• d1f4wl2 first appeared (with stable ids) in SCOP 1.55
  
• d1f4wl2 appears in SCOPe 2.01
  
• d1f4wl2 appears in SCOPe 2.03
  
• d1f4wl2 appears in the current release, SCOPe 2.08