Lineage for d1f4wl2 (1f4w L:111-210)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 290004Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 290069Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)
  8. 290077Domain d1f4wl2: 1f4w L:111-210 [21416]
    Other proteins in same PDB: d1f4wh1, d1f4wh2, d1f4wl1
    part of anti-carbohydrate Fab S-20-4

Details for d1f4wl2

PDB Entry: 1f4w (more details), 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4wl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettnpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d1f4wl2:

Click to download the PDB-style file with coordinates for d1f4wl2.
(The format of our PDB-style files is described here.)

Timeline for d1f4wl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4wl1