Lineage for d3o4ga2 (3o4g A:322-581)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1384030Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
    closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
    automatically mapped to Pfam PF12697
  6. 1384031Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)
  7. 1384032Species Aeropyrum pernix [TaxId:56636] [117713] (8 PDB entries)
    Uniprot Q9YBQ2
  8. 1384043Domain d3o4ga2: 3o4g A:322-581 [214150]
    Other proteins in same PDB: d3o4ga1, d3o4gb1, d3o4gc1, d3o4gd1
    automated match to d1ve6a2
    complexed with gol

Details for d3o4ga2

PDB Entry: 3o4g (more details), 2.5 Å

PDB Description: Structure and Catalysis of Acylaminoacyl Peptidase
PDB Compounds: (A:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d3o4ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4ga2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

SCOPe Domain Coordinates for d3o4ga2:

Click to download the PDB-style file with coordinates for d3o4ga2.
(The format of our PDB-style files is described here.)

Timeline for d3o4ga2: