Lineage for d1f4xh2 (1f4x H:118-216)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8475Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [49102] (3 PDB entries)
  8. 8476Domain d1f4xh2: 1f4x H:118-216 [21415]
    Other proteins in same PDB: d1f4xh1, d1f4xl1

Details for d1f4xh2

PDB Entry: 1f4x (more details), 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4xh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4xh2 b.1.1.2 (H:118-216) Immunoglobulin (constant domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1f4xh2:

Click to download the PDB-style file with coordinates for d1f4xh2.
(The format of our PDB-style files is described here.)

Timeline for d1f4xh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f4xh1