![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.0: automated matches [191451] (1 protein) not a true family |
![]() | Protein automated matches [190689] (87 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [196426] (9 PDB entries) |
![]() | Domain d3o4fh_: 3o4f H: [214148] automated match to d2o06a_ complexed with so4 |
PDB Entry: 3o4f (more details), 2.9 Å
SCOPe Domain Sequences for d3o4fh_:
Sequence, based on SEQRES records: (download)
>d3o4fh_ c.66.1.0 (H:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kqwhetlhdqfgqyfavdnvlyhektdhqdliifenaafgrvmaldgvvqtterdefiyh emmthvpllahghakhvliigggdgamlrevtrhknvesitmveidagvvsfcrqylpnh nagsyddprfklviddgvnfvnqtsqtfdviisdctdpigpgeslftsafyegckrclnp ggifvaqngvcflqqeeaidshrklshyfsdvgfyqaaiptyyggimtfawatdndalrh lsteiiqarflasglkcryynpaihtaafalpqylqdal
>d3o4fh_ c.66.1.0 (H:) automated matches {Escherichia coli K-12 [TaxId: 83333]} kqwhetlhdqfgqyfavdnvlyheqdliifenaafgrvmaldgvvqtterdefiyhemmt hvpllahghakhvliigggdgamlrevtrhknvesitmveidagvvsfcrqylpnhnags yddprfklviddgvnfvnqtsqtfdviisdctsafyegckrclnpggifvaqngvcflqq eeaidshrklshyfsdvgfyqaaiptyyggimtfawatdndalrhlsteiiqarflasgl kcryynpaihtaafalpqylqdal
Timeline for d3o4fh_: