SCOP 1.55: Domain d1f4xl2: 1f4x L:111-210

Lineage for d1f4xl2 (1f4x L:111-210)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain [49102] (3 PDB entries)

8. Domain d1f4xl2: 1f4x L:111-210 [21414]
   Other proteins in same PDB: d1f4xh1, d1f4xl1

Details for d1f4xl2

PDB Entry: 1f4x, 2.3 Å

PDB Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen

SCOP Domain Sequences for d1f4xl2:

Sequence; same for both SEQRES and ATOM records:

>d1f4xl2 b.1.1.2 (L:111-210) Immunoglobulin (constant domains of L and H chains) {Anti-carbohydrate Fab S-20-4 (mouse), lambda L chain}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettnpskq
snnkymassyltltarawerhssyscqvtheghtveksls

Timeline for d1f4xl2:

• d1f4xl2 appears in SCOP 1.57
  
• d1f4xl2 appears in the current release, SCOPe 2.08