Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries) |
Domain d3o3ta2: 3o3t A:92-241 [214139] Other proteins in same PDB: d3o3ta1 automated match to d1k0ma1 mutant |
PDB Entry: 3o3t (more details), 1.7 Å
SCOPe Domain Sequences for d3o3ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o3ta2 a.45.1.1 (A:92-241) automated matches {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls nayareefastcpddeeielayeqvakalk
Timeline for d3o3ta2: