SCOPe 2.08: Domain d3o3ta1: 3o3t A:6-91

Lineage for d3o3ta1 (3o3t A:6-91)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d3o3ta1: 3o3t A:6-91 [214138]
   Other proteins in same PDB: d3o3ta2
   automated match to d1k0ma2
   mutant

Details for d3o3ta1

PDB Entry: 3o3t, 1.7 Å

PDB Description: Crystal Structure Analysis of M32A mutant of human CLIC1

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3o3ta1:

Sequence; same for both SEQRES and ATOM records:

>d3o3ta1 c.47.1.0 (A:6-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
fllygtevhtdtnkieefleavlcpp

Timeline for d3o3ta1:

• d3o3ta1 first appeared in SCOPe 2.03
  
• d3o3ta1 appears in SCOPe 2.07