Lineage for d3o3lb_ (3o3l B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2875105Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2875106Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2875718Family c.45.1.4: Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA [117583] (2 proteins)
  6. 2875746Protein automated matches [226916] (1 species)
    not a true protein
  7. 2875747Species Selenomonas ruminantium [TaxId:971] [225167] (4 PDB entries)
  8. 2875749Domain d3o3lb_: 3o3l B: [214137]
    automated match to d3mmjb_
    complexed with 4ip, act, cl, gol

Details for d3o3lb_

PDB Entry: 3o3l (more details), 1.85 Å

PDB Description: Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol (1,3,4,5)tetrakisphosphate
PDB Compounds: (B:) myo-inositol hexaphosphate phosphohydrolase

SCOPe Domain Sequences for d3o3lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o3lb_ c.45.1.4 (B:) automated matches {Selenomonas ruminantium [TaxId: 971]}
eqtvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayv
psregmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswyge
rdwanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaea
agmryfriaatdhvwptpenidrflafyrtlpqdawlhfhseagvgrttafmvmtdmlkn
psvslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgy
qtpwsvwlkshpaka

SCOPe Domain Coordinates for d3o3lb_:

Click to download the PDB-style file with coordinates for d3o3lb_.
(The format of our PDB-style files is described here.)

Timeline for d3o3lb_: