Lineage for d3o2wl2 (3o2w L:108-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370319Domain d3o2wl2: 3o2w L:108-213 [214131]
    Other proteins in same PDB: d3o2wl1
    automated match to d1t66c2
    complexed with flc, o2w, so4, trs

Details for d3o2wl2

PDB Entry: 3o2w (more details), 2.55 Å

PDB Description: Crystal structure of the 1E9 PheL89Ser/LeuH47Trp/MetH100bPhe Fab in complex with a 39A11 transition state analog
PDB Compounds: (L:) Chimeric antibody Fab 1E9, light chain

SCOPe Domain Sequences for d3o2wl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o2wl2 b.1.1.0 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3o2wl2:

Click to download the PDB-style file with coordinates for d3o2wl2.
(The format of our PDB-style files is described here.)

Timeline for d3o2wl2: