Lineage for d1deef2 (1dee F:2622-2723)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1293236Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 1293237Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)
  8. 1293242Domain d1deef2: 1dee F:2622-2723 [21413]
    Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deec1, d1deec2, d1deed1, d1deee1, d1deee2, d1deef1, d1deeg_, d1deeh_
    part of IgM rheumatoid factor Fab

Details for d1deef2

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab
PDB Compounds: (F:) igm rf 2a2

SCOPe Domain Sequences for d1deef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deef2 b.1.1.2 (F:2622-2723) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl

SCOPe Domain Coordinates for d1deef2:

Click to download the PDB-style file with coordinates for d1deef2.
(The format of our PDB-style files is described here.)

Timeline for d1deef2: