Lineage for d1deef2 (1dee F:2622-2723)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221649Species Fab of human IgM RF 2A2 [49101] (2 PDB entries)
  8. 221655Domain d1deef2: 1dee F:2622-2723 [21413]
    Other proteins in same PDB: d1deea1, d1deeb1, d1deec1, d1deed1, d1deee1, d1deef1, d1deeg_, d1deeh_

Details for d1deef2

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab
PDB Compounds: (F:)

SCOP Domain Sequences for d1deef2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deef2 b.1.1.2 (F:2622-2723) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl

SCOP Domain Coordinates for d1deef2:

Click to download the PDB-style file with coordinates for d1deef2.
(The format of our PDB-style files is described here.)

Timeline for d1deef2: