Lineage for d3o22a_ (3o22 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805614Species Human (Homo sapiens) [TaxId:9606] [187833] (51 PDB entries)
  8. 2805617Domain d3o22a_: 3o22 A: [214125]
    automated match to d2a2ua_
    complexed with ola, plm

Details for d3o22a_

PDB Entry: 3o22 (more details), 1.4 Å

PDB Description: Structure-function analysis of human L-Prostaglandin D Synthase bound with fatty acid
PDB Compounds: (A:) Prostaglandin-H2 D-isomerase

SCOPe Domain Sequences for d3o22a_:

Sequence, based on SEQRES records: (download)

>d3o22a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svqpnfqqdkflgrwfsaglasnsswlrekkaalsmaksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrsphwgstysvsvvetdydqyallysqgskgpgedfrmatl
ysrtqtpraelkekftafckaqgftedtivflpqtdkcmt

Sequence, based on observed residues (ATOM records): (download)

>d3o22a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svqpnfqqdkflgrwfsaglasnsswlrekkaalsmaksvvapatdgglnltstflrknq
cetrtmllqpagslgsysyrspstysvsvvetdydqyallysqgskgpgedfrmatlysr
tqtpraelkekftafckaqgftedtivflpqtdkcmt

SCOPe Domain Coordinates for d3o22a_:

Click to download the PDB-style file with coordinates for d3o22a_.
(The format of our PDB-style files is described here.)

Timeline for d3o22a_: