Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab of human IgM RF 2A2 [49101] (2 PDB entries) |
Domain d1deee2: 1dee E:2108-2214 [21412] Other proteins in same PDB: d1deea1, d1deeb1, d1deec1, d1deed1, d1deee1, d1deef1, d1deeg_, d1deeh_ |
PDB Entry: 1dee (more details), 2.7 Å
SCOP Domain Sequences for d1deee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deee2 b.1.1.2 (E:2108-2214) Immunoglobulin (constant domains of L and H chains) {Fab of human IgM RF 2A2} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1deee2: