Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (64 species) not a true protein |
Species Actinoplanes teichomyceticus [TaxId:1867] [189592] (5 PDB entries) |
Domain d3o1aa_: 3o1a A: [214116] automated match to d3cxya_ complexed with hem |
PDB Entry: 3o1a (more details), 2.5 Å
SCOPe Domain Sequences for d3o1aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o1aa_ a.104.1.0 (A:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]} alplphqrlrldpvpefeelqkagplheydtepgmdgrkqwlvtghdevrailadherfs smrpvddeadrallpgilqaydppdhtrlrrtvapaysarrmerlrprieeiveeclddf esvgapvdfvrhaawpipayiaceflgvprddqaelsrmiresresrlprqrtlsglgiv nytkrltsgkrrdpgdgmigvivrehgaeisdeelaglaegnlimaaeqmaaqlavavll lvthpdqmallrekpelidsateevlrhasiveapaprvaladvrmagrdihagdvltcs mlatnrapgdrfditrekathmafghgihhcigaplarlqlrvalpavvgrfpslrlavp eedlrfkpgrpapfaveelplew
Timeline for d3o1aa_: