Lineage for d3o13a1 (3o13 A:34-124)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059284Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2059285Protein automated matches [226834] (5 species)
    not a true protein
  7. 2059304Species Staphylococcus aureus [TaxId:158878] [224865] (3 PDB entries)
  8. 2059308Domain d3o13a1: 3o13 A:34-124 [214113]
    Other proteins in same PDB: d3o13a2
    automated match to d1v1pa1
    complexed with cl, edo

Details for d3o13a1

PDB Entry: 3o13 (more details), 2.05 Å

PDB Description: Crystal structure of a superantigen-like protein (SAV0433) from Staphylococcus aureus MU50 at 2.05 A resolution
PDB Compounds: (A:) Superantigen-like protein

SCOPe Domain Sequences for d3o13a1:

Sequence, based on SEQRES records: (download)

>d3o13a1 b.40.2.0 (A:34-124) automated matches {Staphylococcus aureus [TaxId: 158878]}
evrsqatqdlseyykgrgfeltnvtgykygnkvtfidnsqqidvtltgnekltvkdddev
snvdvfvvregsdksaittsiggitktngtq

Sequence, based on observed residues (ATOM records): (download)

>d3o13a1 b.40.2.0 (A:34-124) automated matches {Staphylococcus aureus [TaxId: 158878]}
evrsqatqdlseyykgrgfeltnvtgykygnkvtfidnsqqidvtltgnekltvkdddev
snvdvfvvregssaittsiggitktngtq

SCOPe Domain Coordinates for d3o13a1:

Click to download the PDB-style file with coordinates for d3o13a1.
(The format of our PDB-style files is described here.)

Timeline for d3o13a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3o13a2