Lineage for d1deed2 (1dee D:1622-1723)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655926Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 655927Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)
  8. 655931Domain d1deed2: 1dee D:1622-1723 [21411]
    Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deec1, d1deec2, d1deed1, d1deee1, d1deee2, d1deef1, d1deeg_, d1deeh_

Details for d1deed2

PDB Entry: 1dee (more details), 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab
PDB Compounds: (D:) igm rf 2a2

SCOP Domain Sequences for d1deed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1deed2 b.1.1.2 (D:1622-1723) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl

SCOP Domain Coordinates for d1deed2:

Click to download the PDB-style file with coordinates for d1deed2.
(The format of our PDB-style files is described here.)

Timeline for d1deed2: