SCOPe 2.08: Domain d3o0rl2: 3o0r L:108-213

Lineage for d3o0rl2 (3o0r L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3o0rl2: 3o0r L:108-213 [214108]
   Other proteins in same PDB: d3o0rh_, d3o0rl1
   automated match to d2fd6l2
   complexed with ca, fe, hec, hem, o

Details for d3o0rl2

PDB Entry: 3o0r, 2.7 Å

PDB Description: Crystal structure of nitric oxide reductase from Pseudomonas aeruginosa in complex with antibody fragment

PDB Compounds: (L:) antibody fab fragment light chain

SCOPe Domain Sequences for d3o0rl2:

Sequence; same for both SEQRES and ATOM records:

>d3o0rl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d3o0rl2:

• d3o0rl2 first appeared in SCOPe 2.03
  
• d3o0rl2 appears in SCOPe 2.07