Lineage for d3o0kd_ (3o0k D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081405Species Brucella melitensis [TaxId:359391] [225946] (1 PDB entry)
  8. 2081409Domain d3o0kd_: 3o0k D: [214106]
    Other proteins in same PDB: d3o0ka2
    automated match to d1hw6a_
    complexed with edo, gol

Details for d3o0kd_

PDB Entry: 3o0k (more details), 1.8 Å

PDB Description: Crystal structure of ALDO/KETO reductase from brucella melitensis
PDB Compounds: (D:) Aldo/keto reductase

SCOPe Domain Sequences for d3o0kd_:

Sequence, based on SEQRES records: (download)

>d3o0kd_ c.1.7.0 (D:) automated matches {Brucella melitensis [TaxId: 359391]}
tvptvklndgnhipqlgygvwqisndeavsavsealkagyrhidtatiygneegvgkain
gsgiaradiflttklwnsdqgyestlkafdtslkklgtdyvdlylihwpmpskdlfmetw
rafiklkeegrvksigvsnfrtadlerlikesgvtpvlnqielhpqfqqdelrlfhgkhd
iateawsplgqgklledptlksiaekhaksvaqiilrwhietgnivipksitparikenf
difdftlngtdhdaitkld

Sequence, based on observed residues (ATOM records): (download)

>d3o0kd_ c.1.7.0 (D:) automated matches {Brucella melitensis [TaxId: 359391]}
tvptvklndgnhipqlgygvwqisndeavsavsealkagyrhidtatiygneegvgkain
gsgiaradiflttklwnsdqgyestlkafdtslkklgtdyvdlylihwpmpskdlfmetw
rafiklkeegrvksigvsnfrtadlerlikesgvtpvlnqielhpqfqqdelrlfhgkhd
iateawsplgklledptlksiaekhaksvaqiilrwhietgnivipksitparikenfdi
fdftlngtdhdaitkld

SCOPe Domain Coordinates for d3o0kd_:

Click to download the PDB-style file with coordinates for d3o0kd_.
(The format of our PDB-style files is described here.)

Timeline for d3o0kd_: