| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3nz8l2: 3nz8 L:108-213 [214092] Other proteins in same PDB: d3nz8a_, d3nz8b1, d3nz8h_, d3nz8l1 automated match to d1t66c2 complexed with gol |
PDB Entry: 3nz8 (more details), 2.7 Å
SCOPe Domain Sequences for d3nz8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nz8l2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne
Timeline for d3nz8l2:
View in 3DDomains from other chains: (mouse over for more information) d3nz8a_, d3nz8b1, d3nz8b2, d3nz8h_ |