SCOPe 2.08: Domain d3nz8b2: 3nz8 B:108-212

Lineage for d3nz8b2 (3nz8 B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3nz8b2: 3nz8 B:108-212 [214090]
   Other proteins in same PDB: d3nz8a_, d3nz8b1, d3nz8h_, d3nz8l1
   automated match to d1t66c2
   complexed with gol

Details for d3nz8b2

PDB Entry: 3nz8, 2.7 Å

PDB Description: crystal structure of the hiv-2 neutralizing fab fragment 7c8

PDB Compounds: (B:) Mouse anti V3 antibody 7C8 Fab, light chain

SCOPe Domain Sequences for d3nz8b2:

Sequence; same for both SEQRES and ATOM records:

>d3nz8b2 b.1.1.2 (B:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d3nz8b2:

• d3nz8b2 first appeared in SCOPe 2.03
  
• d3nz8b2 appears in SCOPe 2.07