![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries) |
![]() | Domain d1deeb2: 1dee B:622-723 [21409] Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deec1, d1deec2, d1deed1, d1deee1, d1deee2, d1deef1, d1deeg_, d1deeh_ part of IgM rheumatoid factor Fab |
PDB Entry: 1dee (more details), 2.7 Å
SCOPe Domain Sequences for d1deeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1deeb2 b.1.1.2 (B:622-723) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr ggkyaatsqvllpskdvaqgtnehvvckvqhpngnkekdvpl
Timeline for d1deeb2: