SCOPe 2.03: Domain d3nywb_: 3nyw B:

Lineage for d3nywb_ (3nyw B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [225965] (1 PDB entry)

8. Domain d3nywb_: 3nyw B: [214086]
   automated match to d3p19d_

Details for d3nywb_

PDB Entry: 3nyw, 2.16 Å

PDB Description: crystal structure of a betaketoacyl-[acp] reductase (fabg) from bacteroides thetaiotaomicron

PDB Compounds: (B:) Putative oxidoreductase

SCOPe Domain Sequences for d3nywb_:

Sequence, based on SEQRES records:

>d3nywb_ c.2.1.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
lditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinviaqygil
ktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplgirvtt
lcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkksii

Sequence, based on observed residues (ATOM records):

>d3nywb_ c.2.1.0 (B:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
lditdctkadteikdihqkygavdilvnaaamfmepvdnfrkimeinviaqygilktvte
imkvqkngyifnvaadggiygstkfallglaeslyrelaplgirvttlcpgwvntdmakk
fkdeemiqpddllntircllnlsenvcikdivfemkksii

Timeline for d3nywb_:

• d3nywb_ is new in SCOPe 2.03-stable
  
• d3nywb_ appears in SCOPe 2.04
  
• d3nywb_ appears in the current release, SCOPe 2.08