Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.0: automated matches [227135] (1 protein) not a true family |
Protein automated matches [226836] (6 species) not a true protein |
Species Jc polyomavirus [TaxId:10632] [224872] (5 PDB entries) |
Domain d3nxgc_: 3nxg C: [214082] automated match to d1vpsa_ complexed with edo, gol |
PDB Entry: 3nxg (more details), 1.95 Å
SCOPe Domain Sequences for d3nxgc_:
Sequence, based on SEQRES records: (download)
>d3nxgc_ b.121.6.0 (C:) automated matches {Jc polyomavirus [TaxId: 10632]} evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysvar iplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhff svggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdp trnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftn rsgsqqwrglsryfkvqlrkrrvkn
>d3nxgc_ b.121.6.0 (C:) automated matches {Jc polyomavirus [TaxId: 10632]} evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysvar iplpnlilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggeale lqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentry fgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqwr glsryfkvqlrkrrvkn
Timeline for d3nxgc_:
View in 3D Domains from other chains: (mouse over for more information) d3nxga_, d3nxgb_, d3nxgd_, d3nxge_ |