SCOPe 2.08: Domain d3nx2b_: 3nx2 B:

Lineage for d3nx2b_ (3nx2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (25 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:418698] [226077] (2 PDB entries)

8. Domain d3nx2b_: 3nx2 B: [214073]
   automated match to d2gc9b_
   complexed with fer

Details for d3nx2b_

PDB Entry: 3nx2, 2.01 Å

PDB Description: Enterobacter sp. Px6-4 Ferulic Acid Decarboxylase in complex with substrate analogues

PDB Compounds: (B:) Ferulic acid decarboxylase

SCOPe Domain Sequences for d3nx2b_:

Sequence; same for both SEQRES and ATOM records:

>d3nx2b_ b.60.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 418698]}
tfdkhdlsgfvgkhlvytydngwnyeiyvkndntidyrihsglvgnrwvkdqeayivrvg
esiykiswteptgtdvslivnlgdslfhgtiffprwvmnnpeptvcfqndhiplmnsyre
agpayptevidefatitfvrdcgannesviacaaselpknfpdn

Timeline for d3nx2b_:

• d3nx2b_ first appeared in SCOPe 2.03
  
• d3nx2b_ appears in SCOPe 2.07