Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Enterobacter sp. [TaxId:418698] [226077] (2 PDB entries) |
Domain d3nx2b_: 3nx2 B: [214073] automated match to d2gc9b_ complexed with fer |
PDB Entry: 3nx2 (more details), 2.01 Å
SCOPe Domain Sequences for d3nx2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nx2b_ b.60.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 418698]} tfdkhdlsgfvgkhlvytydngwnyeiyvkndntidyrihsglvgnrwvkdqeayivrvg esiykiswteptgtdvslivnlgdslfhgtiffprwvmnnpeptvcfqndhiplmnsyre agpayptevidefatitfvrdcgannesviacaaselpknfpdn
Timeline for d3nx2b_: