SCOP 1.67: Domain d1dqdh2: 1dqd H:123-222

Lineage for d1dqdh2 (1dqd H:123-222)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1dqdh2: 1dqd H:123-222 [21407]
   Other proteins in same PDB: d1dqdh1, d1dqdl1, d1dqdl2
   part of Fab HGR-2 F6, a competitive antagonist of the glucagon receptor

Details for d1dqdh2

PDB Entry: 1dqd, 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

SCOP Domain Sequences for d1dqdh2:

Sequence, based on SEQRES records:

>d1dqdh2 b.1.1.2 (H:123-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg

Sequence, based on observed residues (ATOM records):

>d1dqdh2 b.1.1.2 (H:123-222) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg

Timeline for d1dqdh2:

• d1dqdh2 first appeared (with stable ids) in SCOP 1.55
  
• d1dqdh2 appears in SCOP 1.65
  
• d1dqdh2 appears in SCOP 1.69
  
• d1dqdh2 appears in the current release, SCOPe 2.08