Lineage for d32c2b2 (32c2 B:120-218)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53537Species Fab 32C2 against P450-arom, (mouse), kappa L chain [49099] (1 PDB entry)
  8. 53539Domain d32c2b2: 32c2 B:120-218 [21405]
    Other proteins in same PDB: d32c2a1, d32c2b1

Details for d32c2b2

PDB Entry: 32c2 (more details), 3 Å

PDB Description: structure of an activity suppressing fab fragment to cytochrome p450 aromatase

SCOP Domain Sequences for d32c2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d32c2b2 b.1.1.2 (B:120-218) Immunoglobulin (constant domains of L and H chains) {Fab 32C2 against P450-arom, (mouse), kappa L chain}
akttpppvyplvpgslaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiep

SCOP Domain Coordinates for d32c2b2:

Click to download the PDB-style file with coordinates for d32c2b2.
(The format of our PDB-style files is described here.)

Timeline for d32c2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d32c2b1