Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab 32C2 against P450-arom, (mouse), kappa L chain [49099] (1 PDB entry) |
Domain d32c2b2: 32c2 B:120-218 [21405] Other proteins in same PDB: d32c2a1, d32c2b1 |
PDB Entry: 32c2 (more details), 3 Å
SCOP Domain Sequences for d32c2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d32c2b2 b.1.1.2 (B:120-218) Immunoglobulin (constant domains of L and H chains) {Fab 32C2 against P450-arom, (mouse), kappa L chain} akttpppvyplvpgslaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiep
Timeline for d32c2b2: