Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer |
Protein automated matches [190924] (1 species) not a true protein |
Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries) |
Domain d3nsta_: 3nst A: [214042] automated match to d3nw4a_ complexed with fe2, gol; mutant |
PDB Entry: 3nst (more details), 2.4 Å
SCOPe Domain Sequences for d3nsta_:
Sequence, based on SEQRES records: (download)
>d3nsta_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]} mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel vpvgrggerralglanpglggnayisptmwaaiqylgpretapehrhsqnafrfvvegeg vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd rvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqp atvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvm ngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq
>d3nsta_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]} mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel vpvgrggerralglanpglggnayisptmwaaiqylgpretapehrhsqnafrfvvegeg vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd yatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatva pghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmnget tklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq
Timeline for d3nsta_: