![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries) |
![]() | Domain d32c2a2: 32c2 A:111-217 [21404] Other proteins in same PDB: d32c2a1, d32c2b1, d32c2b2 part of the cytochrome P450-arom activity suppressing Fab 32C2 |
PDB Entry: 32c2 (more details), 3 Å
SCOP Domain Sequences for d32c2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d32c2a2 b.1.1.2 (A:111-217) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d32c2a2: