SCOPe 2.06: Domain d3nr3a1: 3nr3 A:3-132

Lineage for d3nr3a1 (3nr3 A:3-132)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.0: automated matches [191454] (1 protein)
   not a true family

6. Protein automated matches [190698] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187833] (30 PDB entries)

8. Domain d3nr3a1: 3nr3 A:3-132 [214036]
   Other proteins in same PDB: d3nr3a2
   automated match to d1b56a_
   complexed with cit, cl, epe, gol, plm, so4

Details for d3nr3a1

PDB Entry: 3nr3, 1.95 Å

PDB Description: crystal structure of human peripheral myelin protein 2

PDB Compounds: (A:) PMP2 protein

SCOPe Domain Sequences for d3nr3a1:

Sequence; same for both SEQRES and ATOM records:

>d3nr3a1 b.60.1.0 (A:3-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestfknte
isfklgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckmkg
vvctriyekv

Timeline for d3nr3a1:

• d3nr3a1 first appeared in SCOPe 2.03, called d3nr3a_
  
• d3nr3a1 was called d3nr3a_ in SCOPe 2.05
  
• d3nr3a1 appears in SCOPe 2.07
  
• d3nr3a1 appears in the current release, SCOPe 2.08