SCOPe 2.05: Domain d3npma2: 3npm A:151-308

Lineage for d3npma2 (3npm A:151-308)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (6 species)

7. Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
   Uniprot P00479

8. Domain d3npma2: 3npm A:151-308 [214035]
   automated match to d1ekxa2
   complexed with po4

Details for d3npma2

PDB Entry: 3npm, 2.1 Å

PDB Description: Crystal Structure of the C47A/A241C disulfide-linked C6 Aspartate Transcarbamoylase enzyme

PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d3npma2:

Sequence; same for both SEQRES and ATOM records:

>d3npma2 c.78.1.1 (A:151-308) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseycnvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdl

Timeline for d3npma2:

• d3npma2 first appeared in SCOPe 2.03
  
• d3npma2 appears in SCOPe 2.04
  
• d3npma2 appears in SCOPe 2.06
  
• d3npma2 appears in the current release, SCOPe 2.08