Lineage for d3npkb1 (3npk B:2-278)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2010912Species Campylobacter jejuni [TaxId:195099] [225924] (1 PDB entry)
  8. 2010914Domain d3npkb1: 3npk B:2-278 [214033]
    Other proteins in same PDB: d3npka2, d3npkb2
    automated match to d1vg2a_
    complexed with gol, ppv

Details for d3npkb1

PDB Entry: 3npk (more details), 1.5 Å

PDB Description: The crystal structure of geranyltranstransferase from Campylobacter jejuni
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d3npkb1:

Sequence, based on SEQRES records: (download)

>d3npkb1 a.128.1.0 (B:2-278) automated matches {Campylobacter jejuni [TaxId: 195099]}
nlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnqal
dvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvlsh
ahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarliaaal
kmgceicelnneesnqiyklglklglifqinddiidvttsqeqsgkptnndihknsfvnl
lgleqaiktkenllneceqdleklneklaqmiqnlii

Sequence, based on observed residues (ATOM records): (download)

>d3npkb1 a.128.1.0 (B:2-278) automated matches {Campylobacter jejuni [TaxId: 195099]}
nlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnqal
dvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvlsh
ahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarliaaal
kmgceicelnneesnqiyklglklglifqinddiidnsfvnllgleqaiktkenllnece
qdleklneklaqmiqnlii

SCOPe Domain Coordinates for d3npkb1:

Click to download the PDB-style file with coordinates for d3npkb1.
(The format of our PDB-style files is described here.)

Timeline for d3npkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3npkb2