![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:195099] [225924] (1 PDB entry) |
![]() | Domain d3npka1: 3npk A:2-281 [214032] Other proteins in same PDB: d3npka2, d3npkb2 automated match to d1vg2a_ complexed with gol, ppv |
PDB Entry: 3npk (more details), 1.5 Å
SCOPe Domain Sequences for d3npka1:
Sequence, based on SEQRES records: (download)
>d3npka1 a.128.1.0 (A:2-281) automated matches {Campylobacter jejuni [TaxId: 195099]} nlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnqal dvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvlsh ahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarliaaal kmgceicelnneesnqiyklglklglifqinddiidvttsqeqsgkptnndihknsfvnl lgleqaiktkenllneceqdleklneklaqmiqnliiqyl
>d3npka1 a.128.1.0 (A:2-281) automated matches {Campylobacter jejuni [TaxId: 195099]} nlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnqal dvalalefihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvlsh ahlkdeikikliktlafnaglngmvigqaidcffedkrlslneleflhthktarliaaal kmgceicelnneesnqiyklglklglifqinddiidvtnsfvnllgleqaiktkenllne ceqdleklneklaqmiqnliiqyl
Timeline for d3npka1: