Lineage for d3noxa2 (3nox A:509-766)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152916Species Human (Homo sapiens) [TaxId:9606] [188340] (73 PDB entries)
  8. 2152973Domain d3noxa2: 3nox A:509-766 [214029]
    Other proteins in same PDB: d3noxa1, d3noxb1
    automated match to d1orva2
    complexed with 6a5, gol, nag

Details for d3noxa2

PDB Entry: 3nox (more details), 2.34 Å

PDB Description: crystal structure of human dpp-iv in complex with sa-(+)-(6- (aminomethyl)-5-(2,4-dichlorophenyl)-7-methylimidazo[1,2-a]pyrimidin- 2-yl)(morpholino)methanone
PDB Compounds: (A:) Dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2)

SCOPe Domain Sequences for d3noxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3noxa2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d3noxa2:

Click to download the PDB-style file with coordinates for d3noxa2.
(The format of our PDB-style files is described here.)

Timeline for d3noxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3noxa1