Lineage for d3noxa1 (3nox A:40-508)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2810010Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2810011Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2810294Protein automated matches [226889] (4 species)
    not a true protein
  7. 2810295Species Human (Homo sapiens) [TaxId:9606] [225823] (3 PDB entries)
  8. 2810298Domain d3noxa1: 3nox A:40-508 [214028]
    Other proteins in same PDB: d3noxa2, d3noxb2
    automated match to d1orva1
    complexed with 6a5, gol, nag

Details for d3noxa1

PDB Entry: 3nox (more details), 2.34 Å

PDB Description: crystal structure of human dpp-iv in complex with sa-(+)-(6- (aminomethyl)-5-(2,4-dichlorophenyl)-7-methylimidazo[1,2-a]pyrimidin- 2-yl)(morpholino)methanone
PDB Compounds: (A:) Dipeptidyl-peptidase 4 (CD26, adenosine deaminase complexing protein 2)

SCOPe Domain Sequences for d3noxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3noxa1 b.70.3.1 (A:40-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg
hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp
vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn
gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv
tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc
lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk
gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv
sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d3noxa1:

Click to download the PDB-style file with coordinates for d3noxa1.
(The format of our PDB-style files is described here.)

Timeline for d3noxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3noxa2