Class b: All beta proteins [48724] (180 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) automatically mapped to Pfam PF00930 |
Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins) Pfam PF00930 |
Protein automated matches [226889] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225823] (3 PDB entries) |
Domain d3noxa1: 3nox A:40-508 [214028] Other proteins in same PDB: d3noxa2, d3noxb2 automated match to d1orva1 complexed with 6a5, gol, nag |
PDB Entry: 3nox (more details), 2.34 Å
SCOPe Domain Sequences for d3noxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3noxa1 b.70.3.1 (A:40-508) automated matches {Human (Homo sapiens) [TaxId: 9606]} rktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdefg hsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwsp vghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspn gtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssv tnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnc lvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitk gtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysv sfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq
Timeline for d3noxa1: